Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA2A Rabbit Polyclonal Antibody (Biotin)

ADORA2A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A2aR, RDC8, ADORA2

UniProt

P29274

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ADORA2A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000666

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPCAM (Epithelial Cell Adhesion and Activating Molecule, TACSTD1, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, KS1/4, KSA, M4S1, MIC18, MK-1, TACST-1, TACSTD1, TROP1, hEGP-2, CD326) (MaxLight 405)
MBS6415974-01 0.1 mL

EPCAM (Epithelial Cell Adhesion and Activating Molecule, TACSTD1, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, KS1/4, KSA, M4S1, MIC18, MK-1, TACST-1, TACSTD1, TROP1, hEGP-2, CD326) (MaxLight 405)

Sign In for Pricing
View Details
EPCAM (Epithelial Cell Adhesion and Activating Molecule, TACSTD1, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, KS1/4, KSA, M4S1, MIC18, MK-1, TACST-1, TACSTD1, TROP1, hEGP-2, CD326) (MaxLight 405)
MBS6415974-02 5x 0.1 mL

EPCAM (Epithelial Cell Adhesion and Activating Molecule, TACSTD1, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, KS1/4, KSA, M4S1, MIC18, MK-1, TACST-1, TACSTD1, TROP1, hEGP-2, CD326) (MaxLight 405)

Sign In for Pricing
View Details
Dusp9 3'UTR GFP Stable Cell Line
TU253701 1.0 mL

Dusp9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PVRL3 Protein Vector (Rat) (pPB-C-His)
PV297466 500 ng

PVRL3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Human Putative uncharacterized protein C2orf52, C2orf52 ELISA Kit
MBS9330120-01 48 Well

Human Putative uncharacterized protein C2orf52, C2orf52 ELISA Kit

Sign In for Pricing
View Details
Human Putative uncharacterized protein C2orf52, C2orf52 ELISA Kit
MBS9330120-02 96 Well

Human Putative uncharacterized protein C2orf52, C2orf52 ELISA Kit

Sign In for Pricing
View Details