Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA3 Rabbit Polyclonal Antibody (HRP)

ADORA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A3AR

UniProt

P33765

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ADORA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_065734

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-471-5p miRNA Agomir
abx882818-01 5 nmol

Mouse mmu-miR-471-5p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-471-5p miRNA Agomir
abx882818-02 10 nmol

Mouse mmu-miR-471-5p miRNA Agomir

Sign In for Pricing
View Details
CYB5B Polyclonal Antibody
A62362-020 20 µL

CYB5B Polyclonal Antibody

Sign In for Pricing
View Details
FMR1, NT (Fragile X Mental Retardation 1 Protein, Protein FMR-1, FMRP) (MaxLight 650)
MBS6476827-01 0.1 mL

FMR1, NT (Fragile X Mental Retardation 1 Protein, Protein FMR-1, FMRP) (MaxLight 650)

Sign In for Pricing
View Details
FMR1, NT (Fragile X Mental Retardation 1 Protein, Protein FMR-1, FMRP) (MaxLight 650)
MBS6476827-02 5x 0.1 mL

FMR1, NT (Fragile X Mental Retardation 1 Protein, Protein FMR-1, FMRP) (MaxLight 650)

Sign In for Pricing
View Details
Chicken FGF2 (Fibroblast Growth Factor 2, Basic) ELISA Kit
MBS8801037-01 48 Well

Chicken FGF2 (Fibroblast Growth Factor 2, Basic) ELISA Kit

Sign In for Pricing
View Details