Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTBP1 Rabbit Polyclonal Antibody (Biotin)

LTBP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC163161

UniProt

Q14766

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LTBP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

154kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000618

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mcl-1 MAb (Clone 602901)
MAB8281 100 µg

Human Mcl-1 MAb (Clone 602901)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ACS Polyclonal Antibody
MBS7178374 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ACS Polyclonal Antibody

Sign In for Pricing
View Details
NR2C2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-4636R-BF350 100 µL

NR2C2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal TLR3 Antibody (002) [DyLight 755]
NBP2-90455IR 0.1 mL

Rabbit Monoclonal TLR3 Antibody (002) [DyLight 755]

Sign In for Pricing
View Details
TFPI-2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-1144R-APC-Cy7 100 µL

TFPI-2 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
UBE2DNL (MGC42638, Putative Ubiquitin-conjugating Enzyme E2 D2-like Protein, Ubiquitin Carrier Protein D2-like, Ubiquitin-conjugating Enzyme E2D N-terminal-like, Ubiquitin-protein Ligase D2-like, UBE2D2L) (HRP)
MBS6153526-01 0.1 mL

UBE2DNL (MGC42638, Putative Ubiquitin-conjugating Enzyme E2 D2-like Protein, Ubiquitin Carrier Protein D2-like, Ubiquitin-conjugating Enzyme E2D N-terminal-like, Ubiquitin-protein Ligase D2-like, UBE2D2L) (HRP)

Sign In for Pricing
View Details