Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf64 Rabbit Polyclonal Antibody (Biotin)

C9orf64 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC10999, RP11-575L7.5

UniProt

Q5T6V5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf64

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RVEGWKALHELNPRAADEAAVNWVFVTDTLNFSFWSEQDEHKCVVRYRGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115683

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Epimorphin/Syntaxin 2 Antibody
NBP1-19338-0.025mg 0.025 mg

Rabbit Polyclonal Epimorphin/Syntaxin 2 Antibody

Sign In for Pricing
View Details
CTACK (CCL27, C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-cell-attracting Chemokine, ESkine, IL-11 R-alpha-locus Chemokine, Skinkine, Small-inducible Cytokine A27, ILC, SCYA27, PESKY, Skinkine) (AP)
MBS6403423-01 0.1 mL

CTACK (CCL27, C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-cell-attracting Chemokine, ESkine, IL-11 R-alpha-locus Chemokine, Skinkine, Small-inducible Cytokine A27, ILC, SCYA27, PESKY, Skinkine) (AP)

Sign In for Pricing
View Details
CTACK (CCL27, C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-cell-attracting Chemokine, ESkine, IL-11 R-alpha-locus Chemokine, Skinkine, Small-inducible Cytokine A27, ILC, SCYA27, PESKY, Skinkine) (AP)
MBS6403423-02 5x 0.1 mL

CTACK (CCL27, C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-cell-attracting Chemokine, ESkine, IL-11 R-alpha-locus Chemokine, Skinkine, Small-inducible Cytokine A27, ILC, SCYA27, PESKY, Skinkine) (AP)

Sign In for Pricing
View Details
Human CTSK (Cathepsin K) ELISA Kit
EKF57234 96 Tests

Human CTSK (Cathepsin K) ELISA Kit

Sign In for Pricing
View Details
Zwilch CRISPR Activation Plasmid (m)
sc-426874-ACT 20 µg

Zwilch CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
USP13 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61663R-BF350-01 20 µL

USP13 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details