Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOF1 Rabbit Polyclonal Antibody (HRP)

ELOF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ELF1

UniProt

P60002

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ELOF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD64/FCGR1A Polyclonal Antibody
MY372014-01 50 µg

Anti-Mouse CD64/FCGR1A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD64/FCGR1A Polyclonal Antibody
MY372014-02 100 µg

Anti-Mouse CD64/FCGR1A Polyclonal Antibody

Sign In for Pricing
View Details
Rat Serp2 Pre-designed siRNA Set A
SI212663A 1 Each

Rat Serp2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SPDEF Rabbit Polyclonal Antibody (BF488)
orb1583320 100 µL

SPDEF Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B)
MBS7031243-01 0.01 mg

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B)

Sign In for Pricing
View Details
Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B)
MBS7031243-02 0.05 mg

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B)

Sign In for Pricing
View Details