Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NICN1 Rabbit Polyclonal Antibody (FITC)

NICN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC12936

UniProt

Q9BSH3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115692

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTHRC1 knockout cell line
ABC-KH3713 1 Vial

Human CTHRC1 knockout cell line

Sign In for Pricing
View Details
Recombinant Human DYNLL1 protein (N-6His)
CD01897-01 10 µg

Recombinant Human DYNLL1 protein (N-6His)

Sign In for Pricing
View Details
Recombinant Human DYNLL1 protein (N-6His)
CD01897-02 50 µg

Recombinant Human DYNLL1 protein (N-6His)

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus lspA Protein (aa 1-163) (strain Mu3 / ATCC 700698)
VAng-Cr5881-inquire Inquire

Recombinant Staphylococcus Aureus lspA Protein (aa 1-163) (strain Mu3 / ATCC 700698)

Sign In for Pricing
View Details
PRPF31 (Pre-mRNA-processing Factor 31, U4/U6 Small Nuclear Ribonucleoprotein Prp31, PRP31, hPrp31, RP11, Serologically Defined Breast Cancer Antigen NY-BR-99, U4/U6 snRNP 61kD Protein, Protein 61K) (MaxLight 490)
MBS6202701-01 0.1 mL

PRPF31 (Pre-mRNA-processing Factor 31, U4/U6 Small Nuclear Ribonucleoprotein Prp31, PRP31, hPrp31, RP11, Serologically Defined Breast Cancer Antigen NY-BR-99, U4/U6 snRNP 61kD Protein, Protein 61K) (MaxLight 490)

Sign In for Pricing
View Details
PRPF31 (Pre-mRNA-processing Factor 31, U4/U6 Small Nuclear Ribonucleoprotein Prp31, PRP31, hPrp31, RP11, Serologically Defined Breast Cancer Antigen NY-BR-99, U4/U6 snRNP 61kD Protein, Protein 61K) (MaxLight 490)
MBS6202701-02 5x 0.1 mL

PRPF31 (Pre-mRNA-processing Factor 31, U4/U6 Small Nuclear Ribonucleoprotein Prp31, PRP31, hPrp31, RP11, Serologically Defined Breast Cancer Antigen NY-BR-99, U4/U6 snRNP 61kD Protein, Protein 61K) (MaxLight 490)

Sign In for Pricing
View Details