Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-36 gamma (Il36g)

Product Specifications

Product Name Alternative

Interleukin-1 family member 9; IL-1F9

Abbreviation

Recombinant Mouse Il36g protein

Gene Name

Il36g

UniProt

Q8R460

Expression Region

13-164aa

Organism

Mus musculus (Mouse)

Target Sequence

GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Immunology

Relevance

Functions as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4 (+) T-cells and splenocytes.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maged1 (C-term) Rabbit Polyclonal Antibody
AP26048PU-S 50 µL

Maged1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Alanine tert-Butyl Ester Hydrochloride
TRC-A481015-25G 25 g

L-Alanine tert-Butyl Ester Hydrochloride

Sign In for Pricing
View Details
GRB7 (NM_001030002) Human Over-expression Lysate
LY422282 100 µg

GRB7 (NM_001030002) Human Over-expression Lysate

Sign In for Pricing
View Details
CRABP2 Mouse Monoclonal Antibody [Clone ID: AT2E11]
AM09062PU-N 100 µL

CRABP2 Mouse Monoclonal Antibody [Clone ID: AT2E11]

Sign In for Pricing
View Details
KOR-SA3544 Mouse Monoclonal Antibody [Clone ID: KOR-SA3544]
AM26416RP-N 50 Tests

KOR-SA3544 Mouse Monoclonal Antibody [Clone ID: KOR-SA3544]

Sign In for Pricing
View Details
Human CD40 Ligand/TNFSF5, Tag Free (ECD)
HA210939-01 20 µg

Human CD40 Ligand/TNFSF5, Tag Free (ECD)

Sign In for Pricing
View Details