Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL22 Rabbit Polyclonal Antibody (HRP)

KLHL22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KELCHL

UniProt

Q53GT1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILKNFVAFSRTDKYRQLPLEKVYSLLSSNRLEVSCETEVYEGALLYHYSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_116164

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Serum Amyloid P Component (SAP) ELISA Kit
RD-SAP-Ra-01 96 Tests

Rat Serum Amyloid P Component (SAP) ELISA Kit

Sign In for Pricing
View Details
Rat Serum Amyloid P Component (SAP) ELISA Kit
RD-SAP-Ra-02 48 Tests

Rat Serum Amyloid P Component (SAP) ELISA Kit

Sign In for Pricing
View Details
Human Fas / CD95 Recombinant Rabbit monoclonal Antibody
HA723835 100 µL

Human Fas / CD95 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AIF (AIFM1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
CF811161 100 µg

AIF (AIFM1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]

Sign In for Pricing
View Details
Plant Flavonoids Colorimetric Assay Kit
E-BC-K284-S-01 50 Assays (36 samples)

Plant Flavonoids Colorimetric Assay Kit

Sign In for Pricing
View Details
Plant Flavonoids Colorimetric Assay Kit
E-BC-K284-S-02 100 Assays (86 samples)

Plant Flavonoids Colorimetric Assay Kit

Sign In for Pricing
View Details