Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSH2D Rabbit Polyclonal Antibody (FITC)

HSH2D Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALX, HSH2

UniProt

Q96JZ2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSVSCIEVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENDQLPEEYQQP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_116244

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5, GLC10, GLC1O) (HRP)
130589-HRP 100 µL

NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5, GLC10, GLC1O) (HRP)

Sign In for Pricing
View Details
CHIA antibody
E39-01650 100 µg -100 µL

CHIA antibody

Sign In for Pricing
View Details
C15orf26 shRNA (h) Lentiviral Particles
sc-89938-V 200 µL

C15orf26 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Interleukin 8 Receptor B (IL8RB, IL-8R B, IL-8RB, CD182, CDw128b, Chemokine (C-X-C Motif) Receptor 2, C-X-C Chemokine Receptor Type 2, CXCR2, CXC-R2, CXCR-2, CMKAR2, GRO/MGSA Receptor, High Affinity Interleukin-8 Receptor B, IL-8 Receptor Type 2, IL8R2)
128552 50 µg

Interleukin 8 Receptor B (IL8RB, IL-8R B, IL-8RB, CD182, CDw128b, Chemokine (C-X-C Motif) Receptor 2, C-X-C Chemokine Receptor Type 2, CXCR2, CXC-R2, CXCR-2, CMKAR2, GRO/MGSA Receptor, High Affinity Interleukin-8 Receptor B, IL-8 Receptor Type 2, IL8R2)

Sign In for Pricing
View Details
IGF-II HDR Plasmid (h)
sc-401015-HDR 20 µg

IGF-II HDR Plasmid (h)

Sign In for Pricing
View Details
(R) -2- ((Methoxycarbonyl) amino) -3-methylbutanoic Acid
463697-01 250 mg

(R) -2- ((Methoxycarbonyl) amino) -3-methylbutanoic Acid

Sign In for Pricing
View Details