Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf25 Rabbit Polyclonal Antibody (Biotin)

C2orf25 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CblD, C2orf25, CL25022

UniProt

Q9H3L0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf25

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL27A, CT (RPL27A, 60S ribosomal protein L27a) (PE) discontinued
041203-PE 200 µL

RPL27A, CT (RPL27A, 60S ribosomal protein L27a) (PE) discontinued

Sign In for Pricing
View Details
Mouse Human IgA1+IgA2 , conjugated with TRITC Antibody
orb22226 0.2 mg

Mouse Human IgA1+IgA2 , conjugated with TRITC Antibody

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Peptide deformylase 1 (def1)
MBS1460871-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Peptide deformylase 1 (def1)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Peptide deformylase 1 (def1)
MBS1460871-02 0.1 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Peptide deformylase 1 (def1)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Peptide deformylase 1 (def1)
MBS1460871-03 0.02 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Peptide deformylase 1 (def1)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Peptide deformylase 1 (def1)
MBS1460871-04 0.1 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Peptide deformylase 1 (def1)

Sign In for Pricing
View Details