Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG8 Rabbit Polyclonal Antibody (FITC)

SPAG8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SMP1, BS-84, CT142, HSD-1, SPAG3, CILD28, hSMP-1

UniProt

Q99932

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPAG8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_758516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Transition Protein 2 ELISA Kit
MBS750270-01 48 Well

Chicken Transition Protein 2 ELISA Kit

Sign In for Pricing
View Details
Chicken Transition Protein 2 ELISA Kit
MBS750270-02 96 Well

Chicken Transition Protein 2 ELISA Kit

Sign In for Pricing
View Details
Chicken Transition Protein 2 ELISA Kit
MBS750270-03 5x 96 Well

Chicken Transition Protein 2 ELISA Kit

Sign In for Pricing
View Details
Chicken Transition Protein 2 ELISA Kit
MBS750270-04 10x 96 Well

Chicken Transition Protein 2 ELISA Kit

Sign In for Pricing
View Details
Human AIF-1/Iba1 Recombinant Protein
PROTP55008-01 20 µg

Human AIF-1/Iba1 Recombinant Protein

Sign In for Pricing
View Details
Human AIF-1/Iba1 Recombinant Protein
PROTP55008-02 500 µg

Human AIF-1/Iba1 Recombinant Protein

Sign In for Pricing
View Details