Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMD Rabbit Polyclonal Antibody (HRP)

OMD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIG-, Eig1, MM-1, D15Ertd697, D15Ertd697e, 1190001O17Rik, 1700010A06Rik

UniProt

Q99983

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OMD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005005

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC M007-Dia 200-PP-CRD/1 Personal Protection (PPE) Signs (No Adhesive)
818872 1 Card (1 Panel (s) x 1 Pack)

PIC M007-Dia 200-PP-CRD/1 Personal Protection (PPE) Signs (No Adhesive)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
SIPA551Hu01-01 10 µg

Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
SIPA551Hu01-02 50 µg

Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
SIPA551Hu01-03 200 µg

Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
SIPA551Hu01-04 1 mg

Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)
SIPA551Hu01-05 5 mg

Recombinant Protein Tyrosine Phosphatase Receptor Type H (PTPRH)

Sign In for Pricing
View Details