Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyar Rabbit Polyclonal Antibody (Biotin)

Lyar Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MLZ-264

UniProt

Q08288

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: INELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMKNSLKVHSDSVL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079557

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO4, ID (Small Ubiquitin-related Modifier 4, Small Ubiquitin-like Protein 4, SUMO-4, SMT3H4) (MaxLight 405) discontinued
S8026-22-ML405 100 µL

SUMO4, ID (Small Ubiquitin-related Modifier 4, Small Ubiquitin-like Protein 4, SUMO-4, SMT3H4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
TTR Mouse Monoclonal Antibody (1D7)
orb380575-01 50 μL

TTR Mouse Monoclonal Antibody (1D7)

Sign In for Pricing
View Details
TTR Mouse Monoclonal Antibody (1D7)
orb380575-02 100 µL

TTR Mouse Monoclonal Antibody (1D7)

Sign In for Pricing
View Details
Tas2r110 Protein Vector (Mouse) (pPM-C-HA)
PV236416 500 ng

Tas2r110 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-PGP9.5 Antibody Picoband® (monoclonal, 3E4), Dylight594 Conjugate
M01018-6-Dylight594 100 µg

Anti-PGP9.5 Antibody Picoband® (monoclonal, 3E4), Dylight594 Conjugate

Sign In for Pricing
View Details
UTP6, NT (UTP6, C17orf40, HCA66, MHAT, U3 small nucleolar RNA-associated protein 6 homolog, Hepatocellular carcinoma-associated antigen 66, Multiple hat domains protein) (PE) discontinued
043689-PE 200 µL

UTP6, NT (UTP6, C17orf40, HCA66, MHAT, U3 small nucleolar RNA-associated protein 6 homolog, Hepatocellular carcinoma-associated antigen 66, Multiple hat domains protein) (PE) discontinued

Sign In for Pricing
View Details