Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R1B Rabbit Polyclonal Antibody (FITC)

PPP2R1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PR65B, PP2A-Abeta

UniProt

A8K8B0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_859050

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDOR1 (NR1, NADPH-dependent Diflavin Oxidoreductase 1, NADPH-dependent FMN and FAD-containing Oxidoreductase, Novel Reductase 1) (HRP)
130194-HRP 100 µL

NDOR1 (NR1, NADPH-dependent Diflavin Oxidoreductase 1, NADPH-dependent FMN and FAD-containing Oxidoreductase, Novel Reductase 1) (HRP)

Sign In for Pricing
View Details
Anti-Tartrate Resistant Acid Phosphatase Rabbit pAb
GB11416-100 100 μL

Anti-Tartrate Resistant Acid Phosphatase Rabbit pAb

Sign In for Pricing
View Details
Human CCDC137 qPCR Primer Pair
QH72697S 200 Tests

Human CCDC137 qPCR Primer Pair

Sign In for Pricing
View Details
4-[2- (Pyridin-4-yl) ethoxy]aniline
IXB03674-01 250 mg

4-[2- (Pyridin-4-yl) ethoxy]aniline

Sign In for Pricing
View Details
4-[2- (Pyridin-4-yl) ethoxy]aniline
IXB03674-02 2.5 g

4-[2- (Pyridin-4-yl) ethoxy]aniline

Sign In for Pricing
View Details
Recombinant Deinagkistrodon acutus Zinc metalloproteinase acutolysin-C
MBS1326806-01 0.02 mg (E-Coli)

Recombinant Deinagkistrodon acutus Zinc metalloproteinase acutolysin-C

Sign In for Pricing
View Details