Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem173 Rabbit Polyclonal Antibody (HRP)

Tmem173 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RSTING, Tmem173, RGD1562552

UniProt

I3P832

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmem173

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFAMSQDGKAGFSREDRLEQAKLFCRTLEEILADVPESRNHCRLIVYQES

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD9 Mouse Monoclonal Antibody [Clone ID: OTI4E9]
CF807666 100 µg

KCTD9 Mouse Monoclonal Antibody [Clone ID: OTI4E9]

Sign In for Pricing
View Details
DELE1 (NM_001142603) Human Over-expression Lysate
LY428204 100 µg

DELE1 (NM_001142603) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Uterus
CS507991 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details
5b-Dihydro Progesterone
TRC-D449280-50MG 50 mg

5b-Dihydro Progesterone

Sign In for Pricing
View Details
GPX8 (NM_001008397) Human Over-expression Lysate
LY423424 100 µg

GPX8 (NM_001008397) Human Over-expression Lysate

Sign In for Pricing
View Details
PKC alpha (PRKCA) (N-term) Rabbit Polyclonal Antibody
AP18158PU-N 400 µL

PKC alpha (PRKCA) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details