Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem173 Rabbit Polyclonal Antibody (HRP)

Tmem173 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RSTING, Tmem173, RGD1562552

UniProt

I3P832

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmem173

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFAMSQDGKAGFSREDRLEQAKLFCRTLEEILADVPESRNHCRLIVYQES

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP72 Mouse Monoclonal Antibody [Clone ID: OTI4G4]
CF811116 100 µg

CEP72 Mouse Monoclonal Antibody [Clone ID: OTI4G4]

Sign In for Pricing
View Details
(5R)-5-Hydroxy-3-oxo-6-(benzyloxy)-hexanoic Acid tert-Butyl Ester
TRC-H953610-25MG 25 mg

(5R)-5-Hydroxy-3-oxo-6-(benzyloxy)-hexanoic Acid tert-Butyl Ester

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF568 conjugate, 0.1mg/mL
BNC682712-500 1x 500 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mog (NM_010814) Mouse Recombinant Protein
TP503093 20 µg

Mog (NM_010814) Mouse Recombinant Protein

Sign In for Pricing
View Details
HDAC3 Human Gene Knockout Kit (CRISPR)
KN400605 1 Kit

HDAC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Moesin (MSN/492), CF640R conjugate, 0.1mg/mL
BNC400492-100 1x 100 µL

Moesin (MSN/492), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details