Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem50b Rabbit Polyclonal Antibody (FITC)

Tmem50b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AU015466, AU019872, B230114J08Rik

UniProt

Q9D1X9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_084294

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHGA Antibody
orb1333822 100 µg

CHGA Antibody

Sign In for Pricing
View Details
PPP4R2, ID (PPP4R2, Serine/threonine-protein phosphatase 4 regulatory subunit 2) (FITC)
MBS6336745-01 0.2 mL

PPP4R2, ID (PPP4R2, Serine/threonine-protein phosphatase 4 regulatory subunit 2) (FITC)

Sign In for Pricing
View Details
PPP4R2, ID (PPP4R2, Serine/threonine-protein phosphatase 4 regulatory subunit 2) (FITC)
MBS6336745-02 5x 0.2 mL

PPP4R2, ID (PPP4R2, Serine/threonine-protein phosphatase 4 regulatory subunit 2) (FITC)

Sign In for Pricing
View Details
C4orf28 Rabbit Polyclonal Antibody (APC-Cy7)
orb2508758 100 µL

C4orf28 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
CD191/CCR1 Rabbit Polyclonal Antibody
orb2955261-01 50 µg

CD191/CCR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD191/CCR1 Rabbit Polyclonal Antibody
orb2955261-02 100 µg

CD191/CCR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details