Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNS4 Rabbit Polyclonal Antibody (FITC)

TNS4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CTEN, PP14434

UniProt

Q8IZW8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GTGGSQAELAQSTMSMRKKEESEALDIKYIEVTSARSRCHDGPQHCSSPS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_116254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human EGFR pAb
PA5416-01 50 μL

Rabbit Anti-Human EGFR pAb

Sign In for Pricing
View Details
Rabbit Anti-Human EGFR pAb
PA5416-02 100 μL

Rabbit Anti-Human EGFR pAb

Sign In for Pricing
View Details
PDILT CRISPR/Cas9 KO Plasmid (h)
sc-415041 20 µg

PDILT CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
IL10RA Rabbit Polyclonal Antibody
TA392952 100 µL

IL10RA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dicer (DICER1, DCR1, Endoribonuclease Dicer, Helicase MOI, Helicase with RNase Motif, HERNA, KIAA0928) discontinued
D3520-01T 100 µg

Dicer (DICER1, DCR1, Endoribonuclease Dicer, Helicase MOI, Helicase with RNase Motif, HERNA, KIAA0928) discontinued

Sign In for Pricing
View Details
Glutathione S transferase Omega 1 (GSTO1) Human Over-expression Lysate
orb1366552 20 µg

Glutathione S transferase Omega 1 (GSTO1) Human Over-expression Lysate

Sign In for Pricing
View Details