Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNS4 Rabbit Polyclonal Antibody (HRP)

TNS4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CTEN, PP14434

UniProt

Q8IZW8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTGGSQAELAQSTMSMRKKEESEALDIKYIEVTSARSRCHDGPQHCSSPS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_116254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adapter for 4 x 15/50ml tubes, pack of 2
IPD9600-50T 1 Each

Adapter for 4 x 15/50ml tubes, pack of 2

Sign In for Pricing
View Details
Diethylenetriamine-pentaacetic Acid Calcium Trisodium Salt
TRC-D446318-5G 5 g

Diethylenetriamine-pentaacetic Acid Calcium Trisodium Salt

Sign In for Pricing
View Details
Carnosic acid
SIH-362-10MG 10 mg

Carnosic acid

Sign In for Pricing
View Details
Heptadecanoyl Chloride
TRC-H281055-250MG 250 mg

Heptadecanoyl Chloride

Sign In for Pricing
View Details
EGFR pTyr1092 Rabbit Polyclonal Antibody
AP02379PU-S 50 µL

EGFR pTyr1092 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TPSAB1 Polyclonal Antibody
E-AB-66289-01 60 µL

TPSAB1 Polyclonal Antibody

Sign In for Pricing
View Details