Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL20 Rabbit Polyclonal Antibody (HRP)

FBXL20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fbl2, Fbl20

UniProt

Q96IG2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FBXL20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116264

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 2700097O09Rik activation kit by CRISPRa
GA209305 1 Kit

Mouse 2700097O09Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Bovine Insulin receptor substrate 2 ELISA Kit
OM620407 96 Strip Well

Bovine Insulin receptor substrate 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal TOP1MT Antibody (TOP1MT/488) - IHC-Prediluted
NBP2-48472 7 mL

Mouse Monoclonal TOP1MT Antibody (TOP1MT/488) - IHC-Prediluted

Sign In for Pricing
View Details
Propane-2,2-Diylbis (4,1-Phenylene) Dicarbonochloridate
OR1024912-01 1 g

Propane-2,2-Diylbis (4,1-Phenylene) Dicarbonochloridate

Sign In for Pricing
View Details
Propane-2,2-Diylbis (4,1-Phenylene) Dicarbonochloridate
OR1024912-02 5 g

Propane-2,2-Diylbis (4,1-Phenylene) Dicarbonochloridate

Sign In for Pricing
View Details
Recombinant Bacillus pumilus Orotate phosphoribosyltransferase (pyrE)
MBS1117770-01 0.02 mg (E-Coli)

Recombinant Bacillus pumilus Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details