Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL20 Rabbit Polyclonal Antibody (HRP)

FBXL20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fbl2, Fbl20

UniProt

Q96IG2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FBXL20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116264

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD300E Protein Vector (Rat) (pPB-N-His)
PV258571 500 ng

CD300E Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
IL33 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-2633R-BF350-01 20 µL

IL33 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
IL33 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-2633R-BF350-02 100 µL

IL33 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
CDK8 Rabbit pAb, BF700 conjugated
orb2822902 100 µL

CDK8 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
GALR1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0837102 1.0 µg DNA

GALR1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to Chemerin (CHEM)
MBS2132019-01 0.1 mL

HRP Linked Monoclonal Antibody to Chemerin (CHEM)

Sign In for Pricing
View Details