Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP19 Rabbit Polyclonal Antibody (HRP)

ARHGAP19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp313K217, MGC138804, MGC138805, MGC14258

UniProt

Q14CB8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ARHGAP19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lipocalin like 1 protein (LCNL1) activation kit by CRISPRa
GA118339 1 Kit

Human Lipocalin like 1 protein (LCNL1) activation kit by CRISPRa

Sign In for Pricing
View Details
Mucin 6 (MUC6) (MUC6/916), CF640R conjugate, 0.1mg/mL
BNC400916-500 1x 500 µL

Mucin 6 (MUC6) (MUC6/916), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heat Shock Factor 2 Binding Protein (HSF2BP) Human Gene Knockout Kit (CRISPR)
KN401580 1 Kit

Heat Shock Factor 2 Binding Protein (HSF2BP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPOCK3 (NM_001040159) Human Over-expression Lysate
LY421701 100 µg

SPOCK3 (NM_001040159) Human Over-expression Lysate

Sign In for Pricing
View Details
Zfp600 Mouse Gene Knockout Kit (CRISPR)
KN519899 1 Kit

Zfp600 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KIAA1276 (FAM184B) (NM_015688) Human Over-expression Lysate
LY429468 100 µg

KIAA1276 (FAM184B) (NM_015688) Human Over-expression Lysate

Sign In for Pricing
View Details