Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM141 Rabbit Polyclonal Antibody (HRP)

TMEM141 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC14141, RP11-216L13.7

UniProt

Q96I45

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_116317

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAG1 Antibody
A74155-100UL 100 µL

JAG1 Antibody

Sign In for Pricing
View Details
GADD45A Antibody, HRP conjugated
A22687-100UG 100 µg

GADD45A Antibody, HRP conjugated

Sign In for Pricing
View Details
Wnt4 (NM_009523) Mouse Tagged Lenti ORF Clone
MR226763L3 10 µg

Wnt4 (NM_009523) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GAPDHP14 CRISPR All-in-one AAV vector set (with saCas9)(Human)
21248151 3x 1.0 µg DNA

GAPDHP14 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human Cysteinyl Leukotriene Receptor 1 (CYSLTR1) ELISA Kit
MBS451790-01 48 Tests

Human Cysteinyl Leukotriene Receptor 1 (CYSLTR1) ELISA Kit

Sign In for Pricing
View Details
Human Cysteinyl Leukotriene Receptor 1 (CYSLTR1) ELISA Kit
MBS451790-02 96 Tests

Human Cysteinyl Leukotriene Receptor 1 (CYSLTR1) ELISA Kit

Sign In for Pricing
View Details