Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XAGE1D Rabbit Polyclonal Antibody (FITC)

XAGE1D Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CTP9, CT12.1, CT12.1D

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_597674

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRFP Rabbit pAb, PE-Cy5.5 conjugated
orb2847006 100 µL

TRFP Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
GM-CSF, Human
Z05361-500 500 µg

GM-CSF, Human

Sign In for Pricing
View Details
Anti-Mouse DKK1 Polyclonal Antibody
PMB48101 100 μg

Anti-Mouse DKK1 Polyclonal Antibody

Sign In for Pricing
View Details
CST4 discontinued
312220 100 µL

CST4 discontinued

Sign In for Pricing
View Details
TGIF2LX Polyclonal Antibody
MBS2529949-01 0.02 mL

TGIF2LX Polyclonal Antibody

Sign In for Pricing
View Details
TGIF2LX Polyclonal Antibody
MBS2529949-02 0.06 mL

TGIF2LX Polyclonal Antibody

Sign In for Pricing
View Details