Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XAGE1D Rabbit Polyclonal Antibody (HRP)

XAGE1D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CTP9, CT12.1, CT12.1D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_597674

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF594 conjugate, 0.1mg/mL
BNC940245-100 1x 100 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ANKZF1 Polyclonal Antibody
E-AB-90673-01 60 µL

ANKZF1 Polyclonal Antibody

Sign In for Pricing
View Details
ANKZF1 Polyclonal Antibody
E-AB-90673-02 120 µL

ANKZF1 Polyclonal Antibody

Sign In for Pricing
View Details
ANKZF1 Polyclonal Antibody
E-AB-90673-03 200 µL

ANKZF1 Polyclonal Antibody

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF594 conjugate, 0.1mg/mL
BNC942117-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF640R conjugate, 0.1mg/mL
BNC402622-100 1x 100 µL

MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details