Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA4 Rabbit Polyclonal Antibody (Biotin)

IFNA4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

INFA4, IFN-alpha4a

UniProt

P05014

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNA4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Human, Porcine, Sheep

Tested Applications

WB

NCBI Accession Number

NP_066546

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycine t-Butyl Ester Hydrochloride
TRC-G625175-5G 5 g

Glycine t-Butyl Ester Hydrochloride

Sign In for Pricing
View Details
Myosin (MYL6) Rabbit Polyclonal Antibody
TA368857 100 µL

Myosin (MYL6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565537 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
FISH (SH3PXD2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F5]
TA811757AM 100 µL

FISH (SH3PXD2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F5]

Sign In for Pricing
View Details
Human TRAIL R3 ELISA Kit, 2 x 96-well (pre-coated)
EA101234 2x 96 Well (Pre-Coated)

Human TRAIL R3 ELISA Kit, 2 x 96-well (pre-coated)

Sign In for Pricing
View Details
Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG06F-PA 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details