Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Il20rb Rabbit Polyclonal Antibody (FITC)

Il20rb Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Il2, Fndc, Fndc6, Gm186, Il20R2, AV228068

UniProt

E9Q9A6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Il20rb

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028715

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Follicle-stimulating hormone antibody *Mouse anti-human, monoclonal IgG1*
V100180-AAT 50 µg

Anti-Follicle-stimulating hormone antibody *Mouse anti-human, monoclonal IgG1*

Sign In for Pricing
View Details
SLC7A9 (NM_001126335) Human Over-expression Lysate
LC426676 20 µg

SLC7A9 (NM_001126335) Human Over-expression Lysate

Sign In for Pricing
View Details
Perfluorodecylphosphonic Acid
TRC-P270625-25MG 25 mg

Perfluorodecylphosphonic Acid

Sign In for Pricing
View Details
Mouse CD30 Recombinant Rabbit monoclonal Antibody
HA723929 100 µL

Mouse CD30 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ovary specific acidic protein (MGARP) (C-term) Rabbit Polyclonal Antibody
AP50639PU-N 400 µL

Ovary specific acidic protein (MGARP) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Centrin 3 (CETN3) Mouse Monoclonal Antibody [Clone ID: OTI2C2]
CF805847 100 µg

Centrin 3 (CETN3) Mouse Monoclonal Antibody [Clone ID: OTI2C2]

Sign In for Pricing
View Details