Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Il20rb Rabbit Polyclonal Antibody (FITC)

Il20rb Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Il2, Fndc, Fndc6, Gm186, Il20R2, AV228068

UniProt

E9Q9A6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Il20rb

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028715

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nylon 6,6 trimer
TRC-H596230-10MG 10 mg

Nylon 6,6 trimer

Sign In for Pricing
View Details
TMEM51 (NM_001136216) Human Over-expression Lysate
LY427856 100 µg

TMEM51 (NM_001136216) Human Over-expression Lysate

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL
BNC882579-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Amine Oxidase, Copper Containing 3 (AOC3) ELISA Kit
RDR-AOC3-Mu-01 96 Tests

Mouse Amine Oxidase, Copper Containing 3 (AOC3) ELISA Kit

Sign In for Pricing
View Details
Mouse Amine Oxidase, Copper Containing 3 (AOC3) ELISA Kit
RDR-AOC3-Mu-02 48 Tests

Mouse Amine Oxidase, Copper Containing 3 (AOC3) ELISA Kit

Sign In for Pricing
View Details
FOXK1 Human Gene Knockout Kit (CRISPR)
KN415896 1 Kit

FOXK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details