Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL21 Rabbit Polyclonal Antibody (Biotin)

IL21 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Za11, IL-21, CVID11

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL21

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Porcine, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001193935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FDFT1 shRNA (UAS) - Lentiviral human FDFT1 shRNA (UAS) (25)
GTR15098165 1 Vial

Lentiviral human FDFT1 shRNA (UAS) - Lentiviral human FDFT1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Guinea pig Prolyl endopeptidase (PREP) ELISA Kit
MBS7207202-01 48 Well

Guinea pig Prolyl endopeptidase (PREP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Prolyl endopeptidase (PREP) ELISA Kit
MBS7207202-02 96 Well

Guinea pig Prolyl endopeptidase (PREP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Prolyl endopeptidase (PREP) ELISA Kit
MBS7207202-03 5x 96 Well

Guinea pig Prolyl endopeptidase (PREP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Prolyl endopeptidase (PREP) ELISA Kit
MBS7207202-04 10x 96 Well

Guinea pig Prolyl endopeptidase (PREP) ELISA Kit

Sign In for Pricing
View Details
IL-17B Antibody
orb1248394 0.1 mg

IL-17B Antibody

Sign In for Pricing
View Details