Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL21 Rabbit Polyclonal Antibody (HRP)

IL21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Za11, IL-21, CVID11

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Porcine, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001193935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF11 (PHD Finger Protein 11, BRCA1 C-terminus-associated Protein, Renal Carcinoma Antigen NY-REN-34, BCAP) (AP) discontinued
131247-AP 100 µL

PHF11 (PHD Finger Protein 11, BRCA1 C-terminus-associated Protein, Renal Carcinoma Antigen NY-REN-34, BCAP) (AP) discontinued

Sign In for Pricing
View Details
EIF4H Rabbit Polyclonal Antibody
orb666571-01 30 µL

EIF4H Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF4H Rabbit Polyclonal Antibody
orb666571-02 50 μL

EIF4H Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF4H Rabbit Polyclonal Antibody
orb666571-03 100 µL

EIF4H Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF4H Rabbit Polyclonal Antibody
orb666571-04 200 µL

EIF4H Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human PCDH12 shRNA (UAS) - Lentiviral human PCDH12 shRNA (UAS, iRFP) plasmid
GTR15094636 1 Vial

Lentiviral human PCDH12 shRNA (UAS) - Lentiviral human PCDH12 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details