Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL32 Rabbit Polyclonal Antibody (Biotin)

IL32 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd, IL-32beta, IL-32alpha, IL-32delta, IL-32gamma

UniProt

P24001

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IL32

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RY8 gene break apart probe reagent
FP-332 K Fast probe 100 μL (10-20T), DAPI Staining solution (20T)

P2RY8 gene break apart probe reagent

Sign In for Pricing
View Details
RSPO1 Rabbit Polyclonal Antibody (BF350)
orb2454977 100 µL

RSPO1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Camel N-Acetylglucosamine-1-Phosphotransferase Subunit Gamma (GNPTG) ELISA Kit
MBS9925835-01 48 Well

Camel N-Acetylglucosamine-1-Phosphotransferase Subunit Gamma (GNPTG) ELISA Kit

Sign In for Pricing
View Details
Camel N-Acetylglucosamine-1-Phosphotransferase Subunit Gamma (GNPTG) ELISA Kit
MBS9925835-02 96 Well

Camel N-Acetylglucosamine-1-Phosphotransferase Subunit Gamma (GNPTG) ELISA Kit

Sign In for Pricing
View Details
Camel N-Acetylglucosamine-1-Phosphotransferase Subunit Gamma (GNPTG) ELISA Kit
MBS9925835-03 5x 96 Well

Camel N-Acetylglucosamine-1-Phosphotransferase Subunit Gamma (GNPTG) ELISA Kit

Sign In for Pricing
View Details
Camel N-Acetylglucosamine-1-Phosphotransferase Subunit Gamma (GNPTG) ELISA Kit
MBS9925835-04 10x 96 Well

Camel N-Acetylglucosamine-1-Phosphotransferase Subunit Gamma (GNPTG) ELISA Kit

Sign In for Pricing
View Details