Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL32 Rabbit Polyclonal Antibody (HRP)

IL32 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd, IL-32beta, IL-32alpha, IL-32delta, IL-32gamma

UniProt

P24001

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IL32

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-Acyltransferase like 1
YF-PA19466 50 ug

anti-Acyltransferase like 1

Sign In for Pricing
View Details
Fibroblast Growth Factor 2, Basic (FGF2) Polyclonal Antibody
CAU32852-01 100 µL

Fibroblast Growth Factor 2, Basic (FGF2) Polyclonal Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor 2, Basic (FGF2) Polyclonal Antibody
CAU32852-02 200 µL

Fibroblast Growth Factor 2, Basic (FGF2) Polyclonal Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor 2, Basic (FGF2) Polyclonal Antibody
CAU32852-03 1 mL

Fibroblast Growth Factor 2, Basic (FGF2) Polyclonal Antibody

Sign In for Pricing
View Details
ELF5 Protein Vector (Human) (pPM-C-HA)
19207021 500 ng

ELF5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RpsN Antibody
orb828477 2 mg

RpsN Antibody

Sign In for Pricing
View Details