Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIA2 Rabbit Polyclonal Antibody (FITC)

MIA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CTAGE5

UniProt

Q96PC5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MIA2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_473365

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS15A Conjugated Antibody
C43359 100 µL

RPS15A Conjugated Antibody

Sign In for Pricing
View Details
Xlr3a 3'UTR GFP Stable Cell Line
TU172376 1.0 mL

Xlr3a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor (96-112) (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin
MBS659692-01 1 mg

Granulocyte Macrophage Colony Stimulating Factor (96-112) (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor (96-112) (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin
MBS659692-02 5x 1 mg

Granulocyte Macrophage Colony Stimulating Factor (96-112) (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin

Sign In for Pricing
View Details
PRSS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV713807 1.0 µg DNA

PRSS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse CXCL16 ELISA kit
55R-2086 96 tests

Mouse CXCL16 ELISA kit

Sign In for Pricing
View Details