Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAB39L Rabbit Polyclonal Antibody (HRP)

CAB39L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MO2L, MO25-BETA, bA103J18.3

UniProt

Q9H9S4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CAB39L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human IgG (H&L)-AbFluor 350
MBS9526525-01 0.1 mL

Rabbit Anti Human IgG (H&L)-AbFluor 350

Sign In for Pricing
View Details
Rabbit Anti Human IgG (H&L)-AbFluor 350
MBS9526525-02 1 mL

Rabbit Anti Human IgG (H&L)-AbFluor 350

Sign In for Pricing
View Details
Rabbit Anti Human IgG (H&L)-AbFluor 350
MBS9526525-03 5x 1 mL

Rabbit Anti Human IgG (H&L)-AbFluor 350

Sign In for Pricing
View Details
Mitochondrial Antibody
orb2638080 100 µg

Mitochondrial Antibody

Sign In for Pricing
View Details
HMGB1, CT (HMGB1, HMG1, High mobility group protein B1, High mobility group protein 1) (MaxLight 490) discontinued
036637-ML490 100 µL

HMGB1, CT (HMGB1, HMG1, High mobility group protein B1, High mobility group protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
MCM7 Antibody (N-term)
MBS9207514-01 0.08 mL

MCM7 Antibody (N-term)

Sign In for Pricing
View Details