Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63 Rabbit Polyclonal Antibody (HRP)

CD63 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MLA1, ME491, LAMP-3, OMA81H, TSPAN30

UniProt

P08962

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001771

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIRREL2 (Kin of IRRE-like Protein 2, Kin of Irregular Chiasm-like Protein 2, Nephrin-like Protein 3, NEPH3, UNQ5827/PRO19646, DKFZp564A1164, MGC15718) (MaxLight 405) discontinued
128838-ML405 100 µL

KIRREL2 (Kin of IRRE-like Protein 2, Kin of Irregular Chiasm-like Protein 2, Nephrin-like Protein 3, NEPH3, UNQ5827/PRO19646, DKFZp564A1164, MGC15718) (MaxLight 405) discontinued

Sign In for Pricing
View Details
AKR1C2 (aldo-keto Reductase Family 1, Member C2 (dihydrodiol Dehydrogenase 2; bile Acid Binding Protein; 3-alpha Hydroxysteroid Dehydrogenase, Type III), AKR1C-pseudo, BABP, DD, DD2, DDH2, HAKRD, HBAB, MCDR2)
243203 50 µL

AKR1C2 (aldo-keto Reductase Family 1, Member C2 (dihydrodiol Dehydrogenase 2; bile Acid Binding Protein; 3-alpha Hydroxysteroid Dehydrogenase, Type III), AKR1C-pseudo, BABP, DD, DD2, DDH2, HAKRD, HBAB, MCDR2)

Sign In for Pricing
View Details
SNX1 Antibody
MBS8591303-01 0.1 mg

SNX1 Antibody

Sign In for Pricing
View Details
SNX1 Antibody
MBS8591303-02 0.1 mL (AF405L)

SNX1 Antibody

Sign In for Pricing
View Details
SNX1 Antibody
MBS8591303-03 0.1 mL (AF405S)

SNX1 Antibody

Sign In for Pricing
View Details
SNX1 Antibody
MBS8591303-04 0.1 mL (AF610)

SNX1 Antibody

Sign In for Pricing
View Details