Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASD2 Rabbit Polyclonal Antibody (Biotin)

RASD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Rhes, TEM2

UniProt

Q96D21

Immunogen

The immunogen for Anti-RASD2 antibody is: synthetic peptide directed towards the C-terminal region of Human RHES

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCT

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005261500.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Formin Binding Protein 1 (FNBP1) ELISA Kit
DLR-FNBP1-Hu-48T 48 Tests

Human Formin Binding Protein 1 (FNBP1) ELISA Kit

Sign In for Pricing
View Details
Chicken Free Estriol (fE3) ELISA Kit
NSL0818Ch 96 Tests

Chicken Free Estriol (fE3) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-human family with sequence similarity 120A polyclonal Antibody
MBS710221-01 0.1 mL

Rabbit anti-human family with sequence similarity 120A polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human family with sequence similarity 120A polyclonal Antibody
MBS710221-02 5x 0.1 mL

Rabbit anti-human family with sequence similarity 120A polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-VDR Recombinant Antibody (clone 3C7)
ZG-0021U Each

Rabbit Anti-VDR Recombinant Antibody (clone 3C7)

Sign In for Pricing
View Details
PrePack Octyl Purose® 4 FF
E231-30801-15 1x 1 mL

PrePack Octyl Purose® 4 FF

Sign In for Pricing
View Details