Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Rabbit Polyclonal Antibody (FITC)

ENO2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NSE, HEL-S-279

UniProt

P09104

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ENO2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001966

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPBAP1, Recombinant, Human, aa1-488, His-Tag (HSPBAP1 Protein, HSPB1-associated Protein 1, 27kD Heat Shock Protein-associated Protein 1, Protein Associated With Small Stress Protein 1, PASS1)
H1834-81C-01 10 µg

HSPBAP1, Recombinant, Human, aa1-488, His-Tag (HSPBAP1 Protein, HSPB1-associated Protein 1, 27kD Heat Shock Protein-associated Protein 1, Protein Associated With Small Stress Protein 1, PASS1)

Sign In for Pricing
View Details
HSPBAP1, Recombinant, Human, aa1-488, His-Tag (HSPBAP1 Protein, HSPB1-associated Protein 1, 27kD Heat Shock Protein-associated Protein 1, Protein Associated With Small Stress Protein 1, PASS1)
H1834-81C-02 50 µg

HSPBAP1, Recombinant, Human, aa1-488, His-Tag (HSPBAP1 Protein, HSPB1-associated Protein 1, 27kD Heat Shock Protein-associated Protein 1, Protein Associated With Small Stress Protein 1, PASS1)

Sign In for Pricing
View Details
UltraPAGE 10% 15 Wells
UL15010Gel 10 PCs/Box

UltraPAGE 10% 15 Wells

Sign In for Pricing
View Details
RBM15B Rabbit Polyclonal Antibody (BF594)
orb2455514 100 µL

RBM15B Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
SMARCAD1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Containing DEAD/H Box 1, ETL1, HEL1, ADERM) discontinued
213467-01 20 µL

SMARCAD1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Containing DEAD/H Box 1, ETL1, HEL1, ADERM) discontinued

Sign In for Pricing
View Details
SMARCAD1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Containing DEAD/H Box 1, ETL1, HEL1, ADERM) discontinued
213467-02 100 µL

SMARCAD1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Containing DEAD/H Box 1, ETL1, HEL1, ADERM) discontinued

Sign In for Pricing
View Details