Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO2 Rabbit Polyclonal Antibody (HRP)

ENO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NSE, HEL-S-279

UniProt

P09104

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ENO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001966

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM54B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
20052154 3x 1.0 µg DNA

FAM54B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Kallikrein 8 (KLK8)
TRV-0022547-01 200 µL

FITC-Linked Polyclonal Antibody to Kallikrein 8 (KLK8)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Kallikrein 8 (KLK8)
TRV-0022547-02 1 mL

FITC-Linked Polyclonal Antibody to Kallikrein 8 (KLK8)

Sign In for Pricing
View Details
FOXD4 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
20759154 3x 1.0 µg DNA

FOXD4 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Anti-HNRNPU Antibody (R3Q21)
RHF83601 100 μg

Anti-HNRNPU Antibody (R3Q21)

Sign In for Pricing
View Details
Recombinant Lampanyctus crocodilus Superoxide dismutase [Cu-Zn] (sod1)
MBS1227079-01 0.02 mg (E-Coli)

Recombinant Lampanyctus crocodilus Superoxide dismutase [Cu-Zn] (sod1)

Sign In for Pricing
View Details