Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2W1 Rabbit Polyclonal Antibody (HRP)

CYP2W1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC34287

UniProt

Q8TAV3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2W1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_060251

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTR Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-17892R-BF350-TR 20 µL

MTR Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
C1GALT1 Peptide - middle region
orb2014626 100 µg

C1GALT1 Peptide - middle region

Sign In for Pricing
View Details
BRIX1, CT (BRIX1, BRIX, BXDC2, Ribosome biogenesis protein BRX1 homolog, Brix domain-containing protein 2) (APC) discontinued
032583-APC 200 µL

BRIX1, CT (BRIX1, BRIX, BXDC2, Ribosome biogenesis protein BRX1 homolog, Brix domain-containing protein 2) (APC) discontinued

Sign In for Pricing
View Details
SPATA13 Double Nickase Plasmid (m)
sc-432348-NIC 20 µg

SPATA13 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
RPL19P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
40952111 3x 1.0 µg

RPL19P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Bacillus halodurans Ribonuclease Y (rny), partial
MBS1433688 Inquire

Recombinant Bacillus halodurans Ribonuclease Y (rny), partial

Sign In for Pricing
View Details