Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUT8 Rabbit Polyclonal Antibody (HRP)

FUT8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDGF, CDGF1

UniProt

Q9BYC5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004471

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit GM-CSF Polyclonal Antibody - Biotinylated
KPB1737U 50 µg

Rabbit GM-CSF Polyclonal Antibody - Biotinylated

Sign In for Pricing
View Details
Rhesus Macaque GM-SCF ELISA Kit
NR-E20028 1 Each

Rhesus Macaque GM-SCF ELISA Kit

Sign In for Pricing
View Details
NTRK3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
32255126 3x 1.0µg DNA

NTRK3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human Apolipoprotein A-I (Apo A1) AssayLite™ Antibody (APC Conjugate)
11151-05061 5x 30 µg

Human Apolipoprotein A-I (Apo A1) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
Recombinant Candida glabrata Mediator of RNA polymerase II transcription subunit 22 (SRB6)
MBS1389160-01 0.05 mg (E-Coli)

Recombinant Candida glabrata Mediator of RNA polymerase II transcription subunit 22 (SRB6)

Sign In for Pricing
View Details
Recombinant Candida glabrata Mediator of RNA polymerase II transcription subunit 22 (SRB6)
MBS1389160-02 0.2 mg (E-Coli)

Recombinant Candida glabrata Mediator of RNA polymerase II transcription subunit 22 (SRB6)

Sign In for Pricing
View Details