Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD10 Rabbit Polyclonal Antibody (FITC)

ACAD10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6JQN1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAD10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GPI ethanolamine phosphate transferase 1, Pign ELISA KIT
ELI-21598m 96 Tests

Mouse GPI ethanolamine phosphate transferase 1, Pign ELISA KIT

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT
E1086Mo-01 48 Well

Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT
E1086Mo-02 96 Well

Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT
E1086Mo-03 5x 96 Tests

Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT
E1086Mo-04 10x 96 Tests

Mouse Protein Tyrosine Phosphatase Receptor Type O, PTPRO ELISA KIT

Sign In for Pricing
View Details
PCDH15 polyclonal antibody
orb640969-01 50 μL

PCDH15 polyclonal antibody

Sign In for Pricing
View Details