Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD10 Rabbit Polyclonal Antibody (HRP)

ACAD10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6JQN1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAD10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBNA 3B Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-4698R-PerCP-Cy5.5 100 µL

EBNA 3B Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal Glyoxalase II/HAGH Antibody (002) [mFluor Violet 450 SE]
NBP2-90061MFV450 0.1 mL

Rabbit Monoclonal Glyoxalase II/HAGH Antibody (002) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
STNL W015-297X74-PE-CRD/1 AC Signs
828575 Card of 1 Pictogram(s)

STNL W015-297X74-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
Skint5 Protein Vector (Mouse) (pPB-C-His)
PV229454 500 ng

Skint5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
TDRD10 (NM_001098475) Human Over-expression Lysate
E45H05344-2 20 µg

TDRD10 (NM_001098475) Human Over-expression Lysate

Sign In for Pricing
View Details
TLR4 Antibody
orb2675519-01 50 µL

TLR4 Antibody

Sign In for Pricing
View Details