Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD10 Rabbit Polyclonal Antibody (FITC)

ACAD10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6JQN1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAD10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D2 Rabbit Polyclonal Antibody
HA500325 100 µL

Cyclin D2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD66 (CEA) (C66/1030), CF488A conjugate, 0.1mg/mL
BNC881030-500 1x 500 µL

CD66 (CEA) (C66/1030), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMAD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]
TA507243BM 100 µL

SMAD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]

Sign In for Pricing
View Details
CD272 (BTLA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]
TA505688AM 100 µL

CD272 (BTLA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG1,  20nm
GM-400-20 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG1, 20nm

Sign In for Pricing
View Details
HTR2C Rabbit Polyclonal Antibody
24505 100 µL

HTR2C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details