Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD9 Rabbit Polyclonal Antibody (FITC)

ACAD9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NPD002, MC1DN20

UniProt

Q9H845

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ACAD9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054768

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hepatitis delta virus genotype I Small delta antigen
MBS1091019-01 0.02 mg (Mammalian-Cell)

Recombinant Hepatitis delta virus genotype I Small delta antigen

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype I Small delta antigen
MBS1091019-02 0.1 mg (Mammalian-Cell)

Recombinant Hepatitis delta virus genotype I Small delta antigen

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype I Small delta antigen
MBS1091019-03 1 mg (Mammalian-Cell)

Recombinant Hepatitis delta virus genotype I Small delta antigen

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype I Small delta antigen
MBS1091019-04 5x 1 mg (Mammalian-Cell)

Recombinant Hepatitis delta virus genotype I Small delta antigen

Sign In for Pricing
View Details
P27Kip1 (Cyclin-Dependent Kinase Inhibitor 1B, Cyclin-Dependent Kinase Inhibitor, p27, p27Kip1, CDKN1B, KIP1)
376975 100 µL

P27Kip1 (Cyclin-Dependent Kinase Inhibitor 1B, Cyclin-Dependent Kinase Inhibitor, p27, p27Kip1, CDKN1B, KIP1)

Sign In for Pricing
View Details
Ovalbumin specific IgE (OVA sIgE) Guinea Pig ELISA Kit
F6189 96 Tests

Ovalbumin specific IgE (OVA sIgE) Guinea Pig ELISA Kit

Sign In for Pricing
View Details