Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD9 Rabbit Polyclonal Antibody (HRP)

ACAD9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NPD002, MC1DN20

UniProt

Q9H845

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ACAD9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054768

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDKRB1 Rabbit pAb
E47R23908 100 µL

BDKRB1 Rabbit pAb

Sign In for Pricing
View Details
Quantikine Immunoassay Control Set 780 for Human Chemerin
QC62 1 Set

Quantikine Immunoassay Control Set 780 for Human Chemerin

Sign In for Pricing
View Details
Human GSTpi ELISA Kit
MBS8427197 Inquire

Human GSTpi ELISA Kit

Sign In for Pricing
View Details
Cav3.2 Antibody
orb67393 100 µg

Cav3.2 Antibody

Sign In for Pricing
View Details
IKBKE (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon, IKK-i, IKKE, IKKI, KIAA0151, MGC125294, MGC125295, MGC125297) (AP)
MBS6162117-01 0.1 mL

IKBKE (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon, IKK-i, IKKE, IKKI, KIAA0151, MGC125294, MGC125295, MGC125297) (AP)

Sign In for Pricing
View Details
IKBKE (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon, IKK-i, IKKE, IKKI, KIAA0151, MGC125294, MGC125295, MGC125297) (AP)
MBS6162117-02 5x 0.1 mL

IKBKE (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon, IKK-i, IKKE, IKKI, KIAA0151, MGC125294, MGC125295, MGC125297) (AP)

Sign In for Pricing
View Details