Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOX3 Rabbit Polyclonal Antibody (FITC)

ACOX3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O15254

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ACOX3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003492

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A NH₂
HA16020002.5G 5 g

Polystyrene A NH₂

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF594 conjugate, 0.1mg/mL
BNC943291-500 1x 500 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF568 conjugate, 0.1mg/mL
BNC680700-100 1x 100 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF640R conjugate, 0.1mg/mL
BNC400172-500 1x 500 µL

CD45 / LCA (135-4C5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF405S conjugate, 0.1mg/mL
BNC040021-100 1x 100 µL

Cytokeratin 18 (DC10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF594 conjugate, 0.1mg/mL
BNC942123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details