Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1D1 Rabbit Polyclonal Antibody (HRP)

AKR1D1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CBAS2, SRD5B1, 3o5bred

UniProt

P51857

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AKR1D1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005980

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biglycan (BGN) (NM_001711) Human Recombinant Protein
TP761187 50 µg

Biglycan (BGN) (NM_001711) Human Recombinant Protein

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), CF488A conjugate, 0.1mg/mL
BNC880942-100 1x 100 µL

Milk Fat Globulin (EDM45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DPP2 (DPP7) (NM_013379) Human Recombinant Protein
TP304237M 100 µg

DPP2 (DPP7) (NM_013379) Human Recombinant Protein

Sign In for Pricing
View Details
Thiobarbituric Acid Reactants (TBARS) Colorimetric Assay Kit
E-BC-K298-M-01 48 T (32 samples)

Thiobarbituric Acid Reactants (TBARS) Colorimetric Assay Kit

Sign In for Pricing
View Details
Thiobarbituric Acid Reactants (TBARS) Colorimetric Assay Kit
E-BC-K298-M-02 96 T (80 samples)

Thiobarbituric Acid Reactants (TBARS) Colorimetric Assay Kit

Sign In for Pricing
View Details
Thiobarbituric Acid Reactants (TBARS) Colorimetric Assay Kit
E-BC-K298-M-03 500 Assays (484 samples)

Thiobarbituric Acid Reactants (TBARS) Colorimetric Assay Kit

Sign In for Pricing
View Details