Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aacs Rabbit Polyclonal Antibody (Biotin)

Aacs Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SUR5, 2210408B16Rik

UniProt

Q9D2R0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKFPGVWAHGDYCRINPK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_084486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH5 Rabbit Polyclonal Antibody (HRP)
orb2123918 100 µL

MSH5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TRAF2, CT (TNF Receptor-associated Factor 2, Tumor Necrosis Factor Type 2 Receptor-associated Protein 3, TRAP3) (MaxLight 550)
MBS6503198-01 0.1 mL

TRAF2, CT (TNF Receptor-associated Factor 2, Tumor Necrosis Factor Type 2 Receptor-associated Protein 3, TRAP3) (MaxLight 550)

Sign In for Pricing
View Details
TRAF2, CT (TNF Receptor-associated Factor 2, Tumor Necrosis Factor Type 2 Receptor-associated Protein 3, TRAP3) (MaxLight 550)
MBS6503198-02 5x 0.1 mL

TRAF2, CT (TNF Receptor-associated Factor 2, Tumor Necrosis Factor Type 2 Receptor-associated Protein 3, TRAP3) (MaxLight 550)

Sign In for Pricing
View Details
PIGQ (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit Q, N-acetylglucosamyl Transferase Component GPI1, Phosphatidylinositol-glycan Biosynthesis Class Q Protein, PIG-Q, GPI1, c407A10.1, hGPI1, MGC12693) (PE)
131328-PE 100 µL

PIGQ (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit Q, N-acetylglucosamyl Transferase Component GPI1, Phosphatidylinositol-glycan Biosynthesis Class Q Protein, PIG-Q, GPI1, c407A10.1, hGPI1, MGC12693) (PE)

Sign In for Pricing
View Details
TMEFF1 Mouse Monoclonal Antibody
BF8842-01 100 µL

TMEFF1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TMEFF1 Mouse Monoclonal Antibody
BF8842-02 200 µL

TMEFF1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details