Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aacs Rabbit Polyclonal Antibody (Biotin)

Aacs Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9JMI1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MFLDDFLASGTGAQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCMVHSAGG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EDM13551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2810459M11Rik Recombinant Protein (Mouse)
RP111446 100 µg

2810459M11Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human GAL3ST2 Pre-designed siRNA Set A
SI006021A 1 Each

Human GAL3ST2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse Phpt1 shRNA (UAS) - Lentiviral mouse Phpt1 shRNA (UAS, GFP) (100)
GTR15257949 1 Vial

Lentiviral mouse Phpt1 shRNA (UAS) - Lentiviral mouse Phpt1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
KLHL36 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb875528 100 µL

KLHL36 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Lentiviral mouse Cp shRNA (UAS) - Lentiviral mouse Cp shRNA (UAS, GFP) (100)
GTR15295872 1 Vial

Lentiviral mouse Cp shRNA (UAS) - Lentiviral mouse Cp shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
GPR 150 (GPR150) (NM_199243) Human Over-expression Lysate
LS285601-100ug 100 µg

GPR 150 (GPR150) (NM_199243) Human Over-expression Lysate

Sign In for Pricing
View Details