Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADIPOR2 Rabbit Polyclonal Antibody (HRP)

ADIPOR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAQR2, ACDCR2

UniProt

Q86V24

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ADIPOR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_078827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Pro Protein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-AVI)
MBS2553136-01 0.02 mg

Recombinant Human Pro Protein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-AVI)

Sign In for Pricing
View Details
Recombinant Human Pro Protein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-AVI)
MBS2553136-02 0.1 mg

Recombinant Human Pro Protein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-AVI)

Sign In for Pricing
View Details
Recombinant Human Pro Protein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-AVI)
MBS2553136-03 5x 0.1 mg

Recombinant Human Pro Protein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-AVI)

Sign In for Pricing
View Details
CORO2B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0492008 1.0 µg DNA

CORO2B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Mouse Disks large homolog 4 (Dlg4)
MBS1473008-01 0.02 mg (E-Coli)

Recombinant Mouse Disks large homolog 4 (Dlg4)

Sign In for Pricing
View Details
Recombinant Mouse Disks large homolog 4 (Dlg4)
MBS1473008-02 0.02 mg (Yeast)

Recombinant Mouse Disks large homolog 4 (Dlg4)

Sign In for Pricing
View Details